GLP-3 RT
Triple agonist research compound (GLP-1/GIP/glucagon receptor pathways) studied for metabolic signaling and receptor activity in laboratory models.
Shipped in an insulated package with ice pack to maintain product integrity during transit.
More Info:
Sequence (backbone): YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa) with key modifications: Aib at positions 2 & 20, α-methyl-Leu at 13, C20 fatty diacid conjugation via γ-Glu-AEEA linker on Lys, C-terminal amidation.
• Molecular formula: C₂₂₁H₃₄₂N₄₆O₆₈
• Molecular weight: ≈ 4731 Da
• Framing: Synthetic lipidated 39-amino-acid peptide engineered as a multi-receptor research tool. The fatty-acid side chain and non-natural residues support extended stability studies in metabolic signaling models.
GLP-3 RT
Triple agonist research compound (GLP-1/GIP/glucagon receptor pathways) studied for metabolic signaling and receptor activity in laboratory models.
Shipped in an insulated package with ice pack to maintain product integrity during transit.
More Info:
Sequence (backbone): YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa) with key modifications: Aib at positions 2 & 20, α-methyl-Leu at 13, C20 fatty diacid conjugation via γ-Glu-AEEA linker on Lys, C-terminal amidation.
• Molecular formula: C₂₂₁H₃₄₂N₄₆O₆₈
• Molecular weight: ≈ 4731 Da
• Framing: Synthetic lipidated 39-amino-acid peptide engineered as a multi-receptor research tool. The fatty-acid side chain and non-natural residues support extended stability studies in metabolic signaling models.
